PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462950639
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 2312aa    MW: 260466 Da    PI: 9.1313
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462950639genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B343.94.3e-1441126697
                ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
         B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                +p++ + + ++++p+ f++++ gk   s t++le+++g  ++v++    +  ++v+++GW+ F + +++ke Df++F+++++s f   v ++
  462950639  41 MPKSRSDLTLIIVPNGFLKHFAGK--LSGTIKLESPNGSIYDVEI--AERYTKMVFRRGWETFINTHHIKEDDFLLFQHIENSPF--EVLIL 126
                567777788899******888877..677****************..8888999**************************99999..66555 PP

2B3452e-142593451399
                TT-EE--HHH.HTT---..--SEEEEEETTS.-EEEEEE..EEETTE.EEE-TTHHHHHHHHT--TT-EEEEEE-.SSSEE..EEEEE-S CS
         B3  13 sgrlvlpkkfaeehggkkeesktltledesg.rsWevkliyrkksgr.yvltkGWkeFvkangLkegDfvvFkld.grsefelvvkvfrk 99 
                +  lv++kk+a +h   +++s+++tl+ + + ++W  ++ y+++++r ++l++ W +Fv +n+++egD+++F  + gr++f+++v ++r+
  462950639 259 NTHLVISKKYAFTHF--PHKSMDVTLQRPGNsKKWHPRF-YKRNDNRlCMLKGQWLDFVCDNHVQEGDICLFLPIkGRRKFTFMVYLLRT 345
                4569*******9997..56899******5555*******.88888888*************************77355*******99987 PP

3B3438e-143694571199
                HHTT-EE--HHH.HTT---..--SEEEEEETTS.-EEEEEE..EEETTE.EEE-TTHHHHHHHHT--TT-EEEEEE-.SSSEE..EEEEE-S CS
         B3  11 lksgrlvlpkkfaeehggkkeesktltledesg.rsWevkliyrkksgr.yvltkGWkeFvkangLkegDfvvFkld.grsefelvvkvfrk 99 
                +k +  v++kk+a +h   +++s+++tl+ + + ++W  ++ y+++++r ++l++ W +Fv +n+++egD+++F  + gr++f+++v ++r+
  462950639 369 TKMASAVISKKYAFTHF--PHKSMDVTLQRPGNsKKWHPRF-YKRNDNRlCMLKGQWLDFVCDNHVQEGDICLFLPIkGRRKFTFMVYLLRT 457
                4555679******9997..56899******5555*******.88888888*************************77355*******99987 PP

4B334.82.9e-115776283990
                EETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
         B3  39 edesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                 +   + W+ k+ +  +++r +l++GW  Fv +ngL+ gD+++F+l++++++
  462950639 577 LHCMRKIWKTKMVILPGRRRWFLRQGWPTFVWDNGLRIGDICLFELKKNERK 628
                4446699*****9999999**************************9986443 PP

5B341.23e-136637431198
                HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
         B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                +k++  ++p++f++++ gk   s t++le+++g  ++v +    + +++vl+ GW+ Fv+ ++++e+D+++F+++ + +f   v++f+
  462950639 663 FKHN-TIMPNRFLKHFTGK--LSGTIKLESPNGCLYDVHV--IDRYDKMVLGHGWEAFVDVHHINENDSLLFRHITECRF--EVSIFD 743
                4555.778*****888777..6779***************..55555779***********************9998888..999987 PP

6B337.93.2e-128689511699
                EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEEEE-S CS
         B3  16 lvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvvkvfrk 99 
                l + k++a +h   ++e++ +tl+   ++++W  k+  rk ++ ++l++ W +Fv++n++ egD++vF  ++  ++ +++v+++r+
  462950639 868 LAITKEYAFAHF--PHETTNVTLQRpGTSKKWHPKFYKRKDRSVHLLRGKWLDFVRDNNVHEGDICVFLPTKGaEKYTFTVHLLRA 951
                568888888886..345668999994566*******44555555*************************88666999999999886 PP

7B3383e-12106011381494
                 T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EE CS
         B3   14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvv 94  
                 ++l l  ++a++  +++ +++t++l+    ++W+ k+ +  +++ry l +GW++Fv++ngL++gD+++++l+++ ++ ++  
  462950639 1060 SMLELGSRYATAVHLPS-RGQTVVLKY-MRKVWKAKMAVHCGGRRY-LCGGWSKFVRDNGLRVGDICLLQLKKNeRKLTMEA 1138
                 55667777787777765.455666655.889******655555555.667*********************98756655555 PP

8B340.35.7e-13144315072189
                 HH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
         B3   21 kfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89  
                 +fa+ h ++ +e++t++l+    + We k+ y  ++++ +l +GW +Fv++ngL++gD+++F+l++++e
  462950639 1443 RFASVH-LP-AEGQTVVLQ-CGRKIWETKMMYHTGRRW-TLNRGWPNFVRDNGLRVGDICLFELKKNEE 1507
                 666555.33.345566655.4789******77777655.79**********************998754 PP

9B337.73.7e-12167217531497
                 T-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEEEE CS
         B3   14 grlvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvvkvf 97  
                 + l ++ ++a++h   +++s+ +tle   ++++W   +   k+ g+++l++ W +Fvk+n+L+egD++++  +++ ++ +++v+++
  462950639 1672 ASLGISAEYASAHF--PPKSTNVTLERpGKSKKWHPSY--YKHNGACMLRGQWLDFVKDNHLQEGDICLLFPTKDgRKLSFTVHIL 1753
                 56789999**9998..447889*****5566*******..9***************************998777667777777776 PP

10B332.71.3e-10186619441595
                 -EE--HHH.HTT---..--SEEEEEETTS.-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEE CS
         B3   15 rlvlpkkfaeehggkkeesktltledesg.rsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvvk 95  
                  l ++ k+a++h   ++es+ ++le +   ++W   +   k++g++vl++ W +Fvk+n+++ gD++++  ++  ++ +++v+
  462950639 1866 SLAISAKYASAHF--PHESTIVKLERPGKrKKWHPSY--YKHKGACVLGGQWFDFVKDNHVQKGDICLLFPTKGgRKLSFTVH 1944
                 578999***9997..457889*****55549******..****************************9875543355555555 PP

11B333.95.5e-11205521351496
                 T-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEEE CS
         B3   14 grlvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvvkv 96  
                 + l ++ k+a++h   ++es+ +tle   ++++W   +   k++g +vl++ W +Fvk+n+++egD++++  +++ ++ +++v++
  462950639 2055 ASLAISAKYASAHF--PHESTNVTLERlGTSKKWHPSY--YKHKGLCVLRGEWIDFVKDNHVQEGDICLLFPTKDgRKLSFTVHL 2135
                 557899*******7..457889*****6677*******..****************************99866655666666655 PP